ELISA Recombinant Sulfolobus tokodaii Undecaprenyl-diphosphatase(uppP)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:SµLfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) Uniprot NO.:Q96ZM1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLLDIIIIGIVQGISEWLPISSKTQVLISSHYLLNLPIAIAYSFGLFMEMGSIGSATIY FRKDIMSVFRDRKLLLYLAIITIITGLVGVPLYIISDKLLKNAYDPSIPMIILGIALIVD GLYIRYSRIKIRSFKDLSLKNIILIGIAQGLAALPGVSRSGMTVSTmLFLGIKPDDAFRY SYLAYIPAAVGAVGTTILFSKTNISYVISLIGIGGVLISVISAFIIGmLTIDLLLRFAKR RNIYIIDFTLGGIAIVVSVLTILI Protein Names:Recommended name: Undecaprenyl-diphosphatase EC= 3.6.1.27 Alternative name(s): Undecaprenyl pyrophosphate phosphatase Gene Names:Name:uppP Synonyms:bacA, upk Ordered Locus Names:STK_18130 Expression Region:1-264 Sequence Info:fµLl length protein