ELISA Recombinant Thermoplasma volcanium Probable cobalamin biosynthesis protein CobD(cobD)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) Uniprot NO.:Q97CS1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIVVLIGALSIDIIFGEPKEYIHPVVFSGRVASAIEGYFRKFDNRFRAGILFSIAVIVLT AIPYFLAVYLSSFILVVYVVVSMVILKTTFSITSMGEHIKLITDSLKKGNIMEARMHLSM IVRRDTSRLNENEISSAAIESIAEGLVDGYITPLFFFVFFGLPGAFIARIINTLDSMYGY KDRKNFEFGRFSAFMDTVINYIPARISWFFITFSSDILNYRSKAIPVRRYIRRFDSVNAG WPIASMASALNLRLEKKGHYIVNDDGYQPGVADIEKSMKIYYLAAYSYIVIFVLPLLVIM AVFL Protein Names:Recommended name: Probable cobalamin biosynthesis protein CobD Gene Names:Name:cobD Ordered Locus Names:TV0030 ORF Names:TVG0029865 Expression Region:1-304 Sequence Info:fµLl length protein