ELISA Recombinant Rat Potassium channel subfamily K member 15(Kcnk15)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q8R5I0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRKQSARTAALILCILSYLLVGAAVFDALESEAERSRQRLLARKRGEFRRKYRFSADDYR ELERLALQAEPHRAGRQWRFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPL TLVTFQSLGERLNALVRCLLLAAKRCLGLRRPHVSAENMVVAGLLLCAATLALGAAAFAH FEGWTFFHAYYYCFITLTTIGFGDFVALQRDEALQKKPPYVAFSFLYILLGLTVIGAFLN LVVLRFLASAEAPERAALRRASVFRRGAPESRVRIPYPFHPLETWARDNPAFSPPLSPEA VHDCHSSPDRLRARRKSI Protein Names:Recommended name: Potassium channel subfamily K member 15 Alternative name(s): Acid-sensitive potassium channel protein TASK-5 Short name= rTASK-5 TWIK-related acid-sensitive K(+) channel 5 Gene Names:Name:Kcnk15 Synonyms:Task5 Expression Region:1-318 Sequence Info:fµLl length protein