ELISA Recombinant Rat Voltage-dependent calcium channel gamma-3 subunit(Cacng3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q8VHX0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRMCDRGIQmLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL CVAASEFHRSRHSVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY FGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRST EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKLTMGTLLNSDRDHAFLQFHNSTPKEFK ESLHNNPANRRTTPV Protein Names:Recommended name: Voltage-dependent calcium channel gamma-3 subunit Alternative name(s): Neuronal voltage-gated calcium channel gamma-3 subunit Transmembrane AMPAR regµLatory protein gamma-3 Short name= TARP gamma-3 Gene Names:Name:Cacng3 Expression Region:1-315 Sequence Info:fµLl length protein