ELISA Recombinant Xenopus laevis Apoptosis regulator R11

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q91828 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEGSSRDLVEKFVSKKLSQNEACRKFSNNPNPMPYLMEPSTSERPGEGATQGIVEEEVLQ ALLEATEEFELRYQRAFSDLTSQLHITQDTAQQSFQQVMGELFRDGTNWGRIVAFFSFGR ALCVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGWEAFVGLYGKNAAAQSRESQE RFGRLLTIVmLTGVFALVCYMRRR Protein Names:Recommended name: Apoptosis regµLator R11 Alternative name(s): XR11 Gene Names: Expression Region:1-204 Sequence Info:fµLl length protein