ELISA Recombinant Rat Elongation of very long chain fatty acids protein 6(Elovl6)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q920L6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR KPLVLWSLTLAVFSIFGALRTGAYmLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSK APELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSY YALRAAGFRVSRKFAMFITLSQITQmLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLM YLSYLLLFCHFFFEAYIGKVKKATKAE Protein Names:Recommended name: Elongation of very long chain fatty acids protein 6 EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase Elovl6 ELOVL fatty acid elongase 6 Short name= ELOVL FA elongase 6 Fatty acid elongase 2 Sho Gene Names:Name:Elovl6 Synonyms:Face, Lce Expression Region:1-267 Sequence Info:fµLl length protein