ELISA Recombinant Rickettsia conorii Uncharacterized protein RC0660(RC0660)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Uniprot NO.:Q92HW0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPSSYKLRKKIWKSVYLLITVGILYIGYILIKSGYINEKNDINVTKKSLKDNKNFDLKYN IILKDSIFEGVNKNLNAYKIKTERAIKESNNKYKLDIINAIYNVNQDQTLIINAKEGFLD EESSILDLKNDVKLFFDEIIFNTNDARIDLVNKNITGHSPAKLLYKNSSITSDSFNTKDE NNIIIFKGNVSTIIDLSD
Protein Names:Recommended name: Uncharacterized protein RC0660
Gene Names:Ordered Locus Names:RC0660
Expression Region:1-198
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.