Skip to Content

ELISA Recombinant Rhizobium meliloti Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)

https://www.anagnostics.com/web/image/product.template/153500/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) Uniprot NO.:Q92L23 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPAGRWTATRRTWRSRRRRLVFIVLSVLILPYALIGLYLLEFIHPVSTLmLRDLVLLRGY DRQWVEFDDIAPVLVQSVMMSEDGQFCAHAGIDWAQMRGVVEDALDGEQTRGASTIPMQT VKNLFLWNGRSFVRKAMELPLAIAADFAWSKRRLMEIYLNVAEWGEGIYGIEAAARHHFG VSAAKLSRRQAALLAVSLPNPIDRTAGKPGRGLRRLAAVIERRAGRSGGYITCLYD Protein Names:Recommended name: Monofunctional biosynthetic peptidoglycan transglycosylase Short name= Monofunctional TGase EC= 2.4.2.- Gene Names:Name:mtgA Ordered Locus Names:R03266 ORF Names:SMc03883 Expression Region:1-236 Sequence Info:fµLl length protein

1,584.00 € 1584.0 EUR 1,584.00 €

1,584.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.