ELISA Recombinant Suncus murinus Type I iodothyronine deiodinase(DIO1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Suncus murinus (Asian house shrew) (Musk shrew) Uniprot NO.:Q95N00 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLPGLGLLLKRFGVLVRVALKVAVGKVLLTLWPSAIRPHLLAMSEKTGMAKNPRFTYED WAPTFFSTQYFWFVLKVNWQQLEDRTKQGDIAPDSPVVHLSGQRARLWDFMQGNRPLVLN FGSCSUPSFLFKFDQFKRLVEDFSSVADFLTVYIEEAHASDGWAFKNNVDIRRHRDLQER LQAARLLLDRNPGCPVVVDTMENRSSQLYAALPERLYVLQEGRILYKGGPGPWNYHPEEV HAVLEQLCRSSAQSPRL Protein Names:Recommended name: Type I iodothyronine deiodinase EC= 1.97.1.10 Alternative name(s): 5DI DIOI Type 1 DI Type-I 5'-deiodinase Gene Names:Name:DIO1 Synonyms:TXDI1 Expression Region:1-257 Sequence Info:fµLl length protein