ELISA Recombinant Sulfolobus islandicus filamentous virus Putative transmembrane protein 10(SIFV0010)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:SµLfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) (SIFV) Uniprot NO.:Q914M0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNNFSYFSTIFSIALMSSNAFAGNDTLLVGFCPCIEINTLTLFLSSLYAIKPSDSCSPSY TSNLLNLFCDFVNSSTHLSISVFSSSVLSCFTSCFVIYFYPFFVFDSASYCVFNSSSREG CTSVTIGWG Protein Names:Recommended name: Putative transmembrane protein 10 Gene Names:Name:SIFV0010 Expression Region:1-129 Sequence Info:fµLl length protein