Skip to Content

ELISA Recombinant Ustilago maydis Squalene synthase(ERG9)

https://www.anagnostics.com/web/image/product.template/160387/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus) Uniprot NO.:Q92459 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLLSYILLGFTHPSELRAMIGYKVWRDPLNDIKANPQASGWDRQRMRDCWGFLDLTSRS FAAVIKELKGELSRVICLFYLVLRALDTVEDDMTIPAQRKIPLLVNFYKYLEQPGWNFTE SGPNEKDRQLLVEFDKVIAEYQLLDVGYKTVISDITAKMGAGMASYIELSAKGPLKVAMW KHFDLYCHFVAGLVGEGLSRLFSESKLERPWLGHQLELSNHMGLFLQKTNIIRDYAEDCE EGRYFWPQQCWGDDFAKFESQPDVAKGIIEIKPGHFRPADNELGQRSMYVLSSmLLDAMS HATHALDYLALLKEQSVFNFCAIPQVMAIATLELMFNNPDVFKKNVKIRKGVAVGLILRA VNPRDVAYTFLHYSRKMHARLSPADPNFTRWSVELARIEQWCETYYPSFIAAASEGKPTD IRANALRSWSESRRTQALILKQAKLNGSDASTLDAKSVLEAAQNSALDPRDLMTEDERAA QDKRDRDQMVKFFLIILVGMVTFMGIVALITWEIVWWWTMDTPDPLSVYVKHAYYLVKTQ GWSTVKEVLRTTRLSFEHVWKHGLTSPPKLEL Protein Names:Recommended name: Squalene synthase Short name= SQS Short name= SS EC= 2.5.1.21 Alternative name(s): FPP:FPP farnesyltransferase Farnesyl-diphosphate farnesyltransferase Gene Names:Name:ERG9 ORF Names:UM04374 Expression Region:1-572 Sequence Info:fµLl length protein

1,939.00 € 1939.0 EUR 1,939.00 €

1,939.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.