ELISA Recombinant Saccharomyces cerevisiae Mitochondrial organizing structure protein 1(MOS1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q96VH5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNmLVKTAMGFGVGVFTSVLFF KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV Protein Names:Recommended name: Mitochondrial organizing structure protein 1 Short name= MitOS1 Alternative name(s): Mitochondrial inner membrane organization component of 10 kDa Gene Names:Name:MOS1 Synonyms:MIO10 Ordered Locus Names:YCL057C-A Expression Region:1-97 Sequence Info:fµLl length protein