ELISA Recombinant Rhizobium loti UPF0314 protein mll5005(mll5005)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium loti (strain MAFF303099) (Mesorhizobium loti) Uniprot NO.:Q98CU0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSKPAADDGYSAYEDSWRMGLLLVLGLLIFQAGALYGMGRTPICTCGYVKLWHGVVNSSE NSQHIADWYTFSHIIHGFLFYALVRFLFPRSPIGLRLAFAVLIEGGWELLENSPFIIDRY RAGTISLDYYGDSIINSVSDTLAMVLGFVMARRLPIWVIVSLAILFELGTGYLIRDNLTL NVImLLHPFEAIKQWQSGI Protein Names:Recommended name: UPF0314 protein mLl5005 Gene Names:Ordered Locus Names:mLl5005 Expression Region:1-199 Sequence Info:fµLl length protein