ELISA Recombinant Pongo pygmaeus Gap junction beta-2 protein(GJB2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo pygmaeus (Bornean orangutan) Uniprot NO.:Q8MIT9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDWGALQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGC KNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEE IKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDGFSMQRLVKCNAWPCPNTVDC FVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRYCSGRSKKPV Protein Names:Recommended name: Gap junction beta-2 protein Alternative name(s): Connexin-26 Short name= Cx26 Gene Names:Name:GJB2 Expression Region:1-226 Sequence Info:fµLl length protein