ELISA Recombinant Rat Mas-related G-protein coupled receptor member X1(Mrgprx1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q8R4G1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDPTISSLSTESTTLNKTGHPSCRPILTLSFLVPIITLLGLAGNTIVLWLLGFRMRRKAI SVYVLNLSLADSFFLCCHFIDSLMRIMNFYGIYAHKLSKEILGNAAIIPYISGLSILSAI STERCLSVLWPIWYHCHRPRNMSAIICVLIWVLSFLMGILDWFFSGFLGETHHHLWKNVD FIVTAFLIFLFmLLFGSSLALLVRILCGSRRKPLSRLYVTISLTVMVYLICGLPLGLYLF LLYWFGIHLHYPFCHIYQVTVLLSCVNSSANPIIYFLVGSFRHRKKHRSLKMVLKRALEE TPEEDEYTDSHVQKPTEISERRC Protein Names:Recommended name: Mas-related G-protein coupled receptor member X1 Alternative name(s): Sensory neuron-specific G-protein coupled receptor 1 Gene Names:Name:Mrgprx1 Synonyms:Mrgc, Mrgprc, Mrgprc11, Snsr, Snsr1 Expression Region:1-323 Sequence Info:fµLl length protein