ELISA Recombinant Solanum lycopersicum ASC1-like protein

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Solanum lycopersicum (Tomato) (Lycopersicon escµLentum) Uniprot NO.:Q8W4Y5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLLEGTFLDWEYESYPSYEDFAVLPLFALFFPSVRFLLDRFVFEKVARRLIFGKGQEVV ENETDDRRRRIRKFKESAWKCIYFLSAEVFALVVTYNEPWFTNTRYFWVGPGDQVWPDQM YKSKLKALYMYTGGFYTYSIFALIFWETRRSDFGVSMSHHVATAILIVLSYNIRFARVGS VVLAIHDASDIFLEIGKMSKYSGAEALASFRYLCLSWIILRLIYYPFWVLWSTSYEVLQT LDKEKHKVDGPIYYYIFNSLLFCLLVLHIYWWVLIYRmLVKQIQARGQLSDDVRSDSEDE HED Protein Names:Recommended name: ASC1-like protein Alternative name(s): Alternaria stem canker resistance-like protein Gene Names: Expression Region:1-303 Sequence Info:fµLl length protein