ELISA Recombinant Rat PDZK1-interacting protein 1(Pdzk1ip1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q923S2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLALSLLALGLLAEVAPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEQE PGSTMMITGNKADGVLVGMDGRYSSMASGFRSSEHKNAFENVLEEEGRVRSTPM Protein Names:Recommended name: PDZK1-interacting protein 1 Alternative name(s): 17 kDa membrane-associated protein Gene Names:Name:Pdzk1ip1 Synonyms:Map17 Expression Region:1-114 Sequence Info:fµLl length protein