ELISA Recombinant Rat Trace amine-associated receptor 7e(Taar7e)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q923X6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATDDASFPWDQDSILSRDLLSALSSQLCYENLNRSCIRSPYSPGPRLILHAVFGFSAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGDIYC KFHSSFDVSFCYSSIFHLCFISVDRYIAVSDPLIYLTRFTASVSGKCITFSWFLSIIYSF SLLYTGASEAGLEDLVSALTCVGGCQLAVNQSWVFINFLLFLVPTLVMMTVYSKVFLIAK QQAQNIEKIGKQTARASESYKDRVAKRERKAAKTLGITVAAFLLSWLPYFIDSIIDAFLG FITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSATNLFPE Protein Names:Recommended name: Trace amine-associated receptor 7e Short name= TaR-7e Short name= Trace amine receptor 7e Alternative name(s): Trace amine receptor 14 Short name= TaR-14 Gene Names:Name:Taar7e Synonyms:Ta14, Tar14, Trar14 Expression Region:1-358 Sequence Info:fµLl length protein