ELISA Recombinant Rickettsia conorii CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase(pgsA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rickettsia conorii (strain ATCC VR-613 / Malish 7) Uniprot NO.:Q92JJ2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRIDKNLPNYLTIARIMVIPVIILVFYINNSLARTLGALLFVLASITDFFDGYIARKYNL VTSFGKMFDPIADKLLVGCVIImLLKKDNVDEIPCLLILAREFLVSGLREFLALVKVSVP VSRLAKVKTFLQMFALSILILGSKGSGIIYLDIVGEIILWIAAFLTIITGYSYFKACKKY F Protein Names:Recommended name: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase EC= 2.7.8.5 Alternative name(s): Phosphatidylglycerophosphate synthase Short name= PGP synthase Gene Names:Name:pgsA Ordered Locus Names:RC0075 Expression Region:1-181 Sequence Info:fµLl length protein