Skip to Content

ELISA Recombinant Rhizobium meliloti Potassium-transporting ATPase B chain(kdpB)

https://www.anagnostics.com/web/image/product.template/153515/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) Uniprot NO.:Q92XJ0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNKPTTPNLVDPKILFPAAKAAFVKLDPRQLVRNPVIFVTEAMAALVTLFFVLDVATGG GSRLFSGQIAAWLWFTVLFATFAEAVAEGRGKAQADFLRHTKSELSARKLVAPEGRETKE IPATmLKVGDLVLVQAGELIPGDGEVVEGVASVNESAITGESAPVIREAGGDRSAVTGGT EVLSDWVKVRITTAPGSTFVDRMIALIEGAQRQKTPNEIALSILLSGLTLIFLIAVVTLW GLASYSATVLSVTVLSALLVTLIPTTIGGLLSAIGIAGMDRLVRFNVIATSGRAVEAAGD VDTLLLDKTGTITFGNRMASDFLPVPGVTVEELADAALLASLADETPEGRSIVALATGEF GRGASQTGIDAVVPFTAETRLSGVDHRGRRLRKGAVDSVLRFAGLSDSKIPQEFRQAVDK VARTGGTPLAVADGNRLLGVVHLKDVVKPGIKERFSELRAMGIRTVMVTGDNPITAAAIA SEAGVDDFLAEATPEDKLAYIRKEQNGGRLIAMCGDGTNDAPALAQADVGVAMQTGTQAA REAANMVDLDSSPTKLIEIVEIGKQLLMTRGSLTTFSIANDVAKYFAIIPALFVTTYPAL GVLNIMGLASPQSAILSAVIFNALIIVALIPLALKGVRYRPVGAAALLRGNLLVYGLGGL VLPFAGIKLIDLAVSNLNLV Protein Names:Recommended name: Potassium-transporting ATPase B chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] B chain Potassium-binding and translocating subunit B Potassium-translocating ATPase B chain Gene Names:Name:kdpB Ordered Locus Names:RA1254 ORF Names:SMa2331 Expression Region:1-680 Sequence Info:fµLl length protein

2,053.00 € 2053.0 EUR 2,053.00 €

2,053.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.