ELISA Recombinant Sulfolobus tokodaii UPF0290 protein STK_04650(STK_04650)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:SµLfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) Uniprot NO.:Q975E2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPIIYYVIFAILYYLPALVANGSAPFVKNGTPIDFRKNFVDGRRLLGDGKTFEGLLVAVT FGTTVGIILAKFLGIYWIYVSFIESLLAmLGDMVGAFIKRRLGLARGARAIGLDQLDFIL GATLALIISKISLNIYEFLSIVVIAFVLHILTNNVAYRLKIKSVPW Protein Names:Recommended name: UPF0290 protein STK_04650 Gene Names:Ordered Locus Names:STK_04650 Expression Region:1-166 Sequence Info:fµLl length protein