ELISA Recombinant Sulfolobus tokodaii UPF0290 protein STK_04650(STK_04650)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:SµLfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Uniprot NO.:Q975E2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPIIYYVIFAILYYLPALVANGSAPFVKNGTPIDFRKNFVDGRRLLGDGKTFEGLLVAVT FGTTVGIILAKFLGIYWIYVSFIESLLAmLGDMVGAFIKRRLGLARGARAIGLDQLDFIL GATLALIISKISLNIYEFLSIVVIAFVLHILTNNVAYRLKIKSVPW
Protein Names:Recommended name: UPF0290 protein STK_04650
Gene Names:Ordered Locus Names:STK_04650
Expression Region:1-166
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.