ELISA Recombinant Sulfolobus islandicus rod-shaped virus 1 Uncharacterized protein 268(268)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:SµLfolobus islandicus rod-shaped virus 1 (SIRV-1) (SµLfolobus virus SIRV-1) Uniprot NO.:Q8QL22 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVTYTSISSLLASPFQRLTSSMWNTATLLLYQLYETGGNSLTSILQNGNLYIPNNISAL AGFFQKEVYVSGQPVLTEQDPIYIAGFIGTANQQINQILYSNQQLYYSISQLPKEISYDL YTNLYRTISDLTSTLSSQISQLQKTGINALYSIADFLAYTFTYFYLATVGLANTLNKLTL FLSPPTIEGLQISLSTIPSPIYNGSTIETVRIILQNLSNYIVYIGNKLYNSFPILPGDSL EFHVRNPSNVYAWATGKCTVYALFEVVQ Protein Names:Recommended name: Uncharacterized protein 268 Gene Names:ORF Names:268 Expression Region:1-268 Sequence Info:fµLl length protein