ELISA Recombinant Rat Selenoprotein S(Sels)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q8VHV8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDRGEEPMSARPALETESLRFLHVTVGSLLASYGWYILFSCVLLYIVIQKLSLRLRALRQ RQLDQAEAVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKQRQLEEEKRRQKIEMWD SMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPG RRGPSSGGUS Protein Names:Recommended name: Selenoprotein S Short name= SelS Alternative name(s): Sg2 VCP-interacting membrane protein Gene Names:Name:Sels Synonyms:Vimp Expression Region:1-190 Sequence Info:fµLl length protein