ELISA Recombinant Pyrobaculum aerophilum UPF0290 protein PAE0660(PAE0660)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:PyrobacµLum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) Uniprot NO.:Q8ZYR4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDLTVFFLLIWPPYVANGSAVFASRLKWRHPVDFGRNFIDGRRIFGDGKTYEGVAIGIAT GTVLGYFPNLVYHVIGVFDAFVLSASAVLGDLIGAFIKRRLCMPRGHPAFPLDQLDFLLT AFLVYSLFREIPVVYVLAAVVITPVIHRATNYVAYLLKLKKEPW Protein Names:Recommended name: UPF0290 protein PAE0660 Gene Names:Ordered Locus Names:PAE0660 Expression Region:1-164 Sequence Info:fµLl length protein