ELISA Recombinant Pyrobaculum aerophilum Undecaprenyl-diphosphatase(uppP)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:PyrobacµLum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) Uniprot NO.:Q8ZYX0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDLGVAAILGVVQGISEWLPISSKTQImLVSIWLLNASPEYAYSLGLFLEAASVLAALIY FRGVYLKALRGFVGDAEGRRWLVYILVTTLVTAVVGLPLYYVARKWLVVGHSAGFLMIVL GLAVVLNAVFLQRARFSAGLKAFDNMSLRDMAIVGIAQAVSVLPGLSRSGATVTALLLLG YKPEEAFRASFVLVPVAGLGATALAYLSEGGAVATAEALLAMAIGIVISIITIKALLEFA KSKHVVLVNVVIGLLAIAGGLLRIIF Protein Names:Recommended name: Undecaprenyl-diphosphatase EC= 3.6.1.27 Alternative name(s): Undecaprenyl pyrophosphate phosphatase Gene Names:Name:uppP Synonyms:bacA, upk Ordered Locus Names:PAE0576 Expression Region:1-266 Sequence Info:fµLl length protein