Skip to Content

ELISA Recombinant Rat Palmitoyltransferase ZDHHC7(Zdhhc7)

https://www.anagnostics.com/web/image/product.template/152706/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q923G5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQPSGHRLRDIEHHPLLTDNDNYDSASSSSSEADMADRVWFIRDGCGMVCAVMTWLLVVY ADFVVTFVmLLPSKDFWYSVVNGVLFNCLAVLALSSHLRTmLTDPGAVPKGNATKEYMES LQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTM YIALSSIHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLEGLLFFTFTAVMFGT QIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLQMRTR KGGPEFSV Protein Names:Recommended name: Palmitoyltransferase ZDHHC7 EC= 2.3.1.- Alternative name(s): Sertoli cell gene with a zinc finger domain protein Zinc finger DHHC domain-containing protein 7 Short name= DHHC-7 Gene Names:Name:Zdhhc7 Synonyms:Serz Expression Region:1-308 Sequence Info:fµLl length protein

1,660.00 € 1660.0 EUR 1,660.00 €

1,660.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.