ELISA Recombinant Rhizobium meliloti UPF0060 membrane protein R01043(R01043)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) Uniprot NO.:Q92R68 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPAYAIYFLAALAEITGCFAFWSWLRLGKSALWLIPGMASLALFAWLLTMVDAAAAGRTY AAYGGVYIVASLSWLWLAEGVRPDHWDMTGAAVALAGSAIILAGPR Protein Names:Recommended name: UPF0060 membrane protein R01043 Gene Names:Ordered Locus Names:R01043 ORF Names:SMc02387 Expression Region:1-106 Sequence Info:fµLl length protein