ELISA Recombinant Schizosaccharomyces pombe Meiotic expression up-regulated protein 24(meu24)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q96WS1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNSNYVPLTSSVDVEEKMESENGVDLGNDIDLEKGLPLKYNSENESGLPSNSASSYLINP DPTMDLEAQTFNHNESTTSVGHDNSNSPPKCRKTCSSNKVYSNEVPLLFVFVISISIVCI FDLVIFGCLQYNMVSMDDLHVMQRLSWFCASLALLFILMRYYDFWTKACKDGIKHIFKKW KNTPLAFLQVLIFNIIGFFVRKGLKDSFGEQWGLKTSLFAHVSFATMSIFIFIFETLKPG SCSVDWIARILKAVVYFLEDSDEL Protein Names:Recommended name: Meiotic expression up-regµLated protein 24 Gene Names:Name:meu24 Synonyms:wtf11 ORF Names:SPCC1281.08 Expression Region:1-264 Sequence Info:fµLl length protein