ELISA Recombinant Thermoplasma volcanium UPF0290 protein TV0187(TV0187)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) Uniprot NO.:Q97CB5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNYPLLMAQAIILFVPALIANSGAVLTGGYFVLDRGKNFIDGRRILGDGKTLSGYLGGSF IGIVSGVIIYWISYATHFILGNYGSIALSIEIPAVMAFGSLTGDILGSFVKRRIGIKSGG KGGLLDQWPFALVAFLFLFLMERPFFLHYYFFAGIIVILAIVPPLHRAVNIIGYKLHKKD VPW Protein Names:Recommended name: UPF0290 protein TV0187 Gene Names:Ordered Locus Names:TV0187 ORF Names:TVG0192666 Expression Region:1-183 Sequence Info:fµLl length protein