ELISA Recombinant Pyrococcus furiosus UPF0290 protein PF0398(PF0398)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) Uniprot NO.:Q8U3Q8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHPILEAFWYILPAYFANSSPVILGGGTPIDFGKTWRDGRRIFGDSKTWRGFLGGLTVGT LIGVIQQIIYPYYPSLSLAFKVSFLLALGALVGDLIGSFIKRRLNLPPGYPAVGLDQWGF LISALCFAYPVHTIPTGEVLLLLVVTPLIHWGTNVLAYKMKWKSVPW Protein Names:Recommended name: UPF0290 protein PF0398 Gene Names:Ordered Locus Names:PF0398 Expression Region:1-167 Sequence Info:fµLl length protein