ELISA Recombinant Torpedo marmorata 14 kDa transmembrane protein

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Torpedo marmorata (Marbled electric ray) Uniprot NO.:Q91499 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEYRTDQVPMSPRSVQGAPGTLPIRDHLPWSIFNLFYMNVCCLGLTAMIFSVKSRDRKVV GDVEGARHYGSTARSLNIAATVLGILLIIILIGLAATGTIQALKYKG Protein Names:Recommended name: 14 kDa transmembrane protein Gene Names: Expression Region:1-107 Sequence Info:fµLl length protein