ELISA Recombinant Porcine epidemic diarrhea virus Non-structural protein 3(3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Porcine epidemic diarrhea virus (strain CV777) (PEDV) Uniprot NO.:Q91AV0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFLGLFQYTIDTVVKDVSKSVNLSLDAVQELELNVVPIRQASNVTGFLFTSVFVYFFALF KASSLRRNYImLAARFAVVFLYCPLLYYCGALLDATIICCALIGRLCLVCFYSWRYKNAL FIIFNTTTLSFLNGKAAYYDGKSIVILEGGDHYITFGNSFVAFVSNIDLYLAIRGRQEAD LHLLRTVELLDGKKLYVFSQHQIVGITNAAFDSIQLDEYATISE Protein Names:Recommended name: Non-structural protein 3 Short name= ns3Alternative name(s): Accessory protein 3a Gene Names:ORF Names:3 Expression Region:1-224 Sequence Info:fµLl length protein