ELISA Recombinant Rhizobium meliloti UPF0314 protein R03235(R03235)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) Uniprot NO.:Q92L50 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTIAAGSQDDKQRRAALWLLACLGVLAIQVLVQHLMGRLWICECGYIKLWEGVVKSSGNS QHLSDWYTPSHVIHGFLFYGLGHLLMRGKPWSARLLLATVIESAWEIAENTPMVINRYRA ATISLDYFGDSILNSAMDTLAMAVGFLIASRLPVAATVAIAIVLELFTGYMVRDNLTLNV LmLVWPLDAVKAWQAGV Protein Names:Recommended name: UPF0314 protein R03235 Gene Names:Ordered Locus Names:R03235 ORF Names:SMc03852 Expression Region:1-197 Sequence Info:fµLl length protein