ELISA Recombinant Rhizobium meliloti ATP synthase subunit b-b'(atpG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) Uniprot NO.:Q92RM6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFVTAAYAQSSTTEGAEAHDAAAAGEVHTETGVAHEADHGAGVFPPFDTTHFASQLLWLA ITFGLFYLLMSKVIIPRIGGILETRHDRIAQDLDEASRLKGEADAAIAAYEQELAGARAK GHSIADTAREAAKAKAKADRDGVEAGLAKKIAAAEARIADIKSKALADVGAIAEETATAV VKQLIGGTVTKAEIAAAFKASAGN Protein Names:Recommended name: ATP synthase subunit b/b' Alternative name(s): ATP synthase F(0) sector subunit b/b' ATPase subunit II F-type ATPase subunit b/b' Short name= F-ATPase subunit b/b' Gene Names:Name:atpG Synonyms:atpF2 Ordered Locus Names:R00837 ORF Names:SMc00869 Expression Region:1-204 Sequence Info:fµLl length protein