ELISA Recombinant Rhizobium meliloti sn-glycerol-3-phosphate transport system permease protein ugpA(ugpA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) Uniprot NO.:Q92WD8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQRVVFPNKILPYLLVAPQIVLTIVFFFWPASQALYQSVIREDPFGLKSGFVGFANFSAV LSEANYLNSLKVTVIFSVLTALLAMGVALLLATAADRVVRGKTFYRTLLIWPYAVAPAVA GmLWLFMFNPAMGTFAYmLRRNGFHWDPLLNGNHAMILIVVAAAWKQISYNFLFFVAGLQ AIPKSLIEAAAIDGARGTRRFWTIIFPLLAPTTFFLLVVNTVYAFFDTFGIIHSVTGGGP ARATETLVYKVYNDGFVNLNLGSSAAQSVILMAIVIGLTAFQFRFVEKRVHYG Protein Names:Recommended name: sn-glycerol-3-phosphate transport system permease protein µgpA Gene Names:Name:µgpA Ordered Locus Names:RB0403 ORF Names:SMb20417 Expression Region:1-293 Sequence Info:fµLl length protein