ELISA Recombinant Rhizobium loti Large-conductance mechanosensitive channel 3(mscL3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium loti (strain MAFF303099) (Mesorhizobium loti) Uniprot NO.:Q98B79 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLKEFQEFISKGNVMDLAVGVIIGAAFGKIVTSLVDDVIMPIFGAIFGGLDFNNYYIGLS SAVNATSLAEAKKQGAVFAYGSFITAVLNFLILAFIIFLMVKAVNNLRRRLEREKPAAPA APPPADVALLTEIRDLLAKR Protein Names:Recommended name: Large-conductance mechanosensitive channel 3 Gene Names:Name:mscL3 Ordered Locus Names:mLr5692 Expression Region:1-140 Sequence Info:fµLl length protein