ELISA Recombinant Rhizobium loti Phosphate transport system permease protein pstC(pstC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhizobium loti (strain MAFF303099) (Mesorhizobium loti) Uniprot NO.:Q98FL3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSAVQEALPAVRSSRDATVRRFALTDAIFHATTRAAAILVLVLLGGVAISLFAGSWQALS TFGFSFLTSESWNPVTEKFGALAPIYGTVITSAIAILIAVPLGIGIAIFLTELCPRPLRR PIGMAVELLAGIPSIIYGIWGLFVLAPFLQTTVQPLIISMFHGIPGLNGLFAGPPYGIGL LTSAMILAIMILPFITSITKDVFDTVPSVLKESAYGIGCTTWEVTRRVVIPYTRIGIMGG VmLALGRALGETMAVTFVIGNAHRISTSLFAPATTISATIANEFTEAVGDLYTSSLVALG LILFVITFLILAIARYmLMRIDARTGA Protein Names:Recommended name: Phosphate transport system permease protein pstC Gene Names:Name:pstC Ordered Locus Names:mLl3722 Expression Region:1-327 Sequence Info:fµLl length protein