ELISA Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf12(wtf12)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q8NIP8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKNNYTSLKSSVDEEDELKTGHEIDLEKGPLPEHNSEGESTLPPYSDISKLANLVPEDSS TGPTETANPNVERRQEFKDLHPNIYSLLRLLIAVLAVSVVFFTAWGCVNPLEKSTFGKIA FFVLIGLTCLILLITMILEPGLIGISIMKRLIGDNGNDERDYFVENRLLSSPDCDARQHA NSDTAIPLREMNPESEA Protein Names:Recommended name: Uncharacterized protein wtf12 Gene Names:Name:wtf12 ORF Names:SPCC1281.09, SPCC622.21 Expression Region:1-197 Sequence Info:fµLl length protein