ELISA Recombinant Xanthomonas campestris pv. campestris Protease HtpX(htpX)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xanthomonas campestris pv. campestris (strain ATCC 33913 / NCPPB 528 / LMG 568) Uniprot NO.:Q8P8F0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFNRVVLFLLTNFAVLILAGIVMSVLGVNPTQMSGLLVMAAIFGFGGSFISLLLSKFMAK RSTGAQVITEPRTQTERWLVDTVRRQAQAAGIGMPEVAIYDGPEINAFATGANRNNALVA VSTGLLQHMREDEAEAVLGHEIAHIANGDMVTMALLQGVLNTFVIVLARVVGGIIDSALS GNRDSGRGFAYYIIVFVLEMVFGLFATMIAMWFSRRREFRADAGGAQLAGRNKMIAALER LSLNHGQNTLPSQVQAFGISGGVGEGLRRLFLSHPPLTERIAALRASNGTAM Protein Names:Recommended name: Protease HtpX EC= 3.4.24.- Alternative name(s): Heat shock protein HtpX Gene Names:Name:htpX Ordered Locus Names:XCC2292 Expression Region:1-292 Sequence Info:fµLl length protein