ELISA Recombinant Xanthomonas axonopodis pv. citri UPF0060 membrane protein XAC3064(XAC3064)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xanthomonas axonopodis pv. citri (strain 306) Uniprot NO.:Q8PI34 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTIAPTTLLLFAATALAELVGCYLPYLWLRKGGSVWLLLPTALSLAVFVWLLSLHPEASG RVYAAYGGVYIASALLWLWWVDGVTPTRWDLLGAACCLLGMAVIMFSPRSA Protein Names:Recommended name: UPF0060 membrane protein XAC3064 Gene Names:Ordered Locus Names:XAC3064 Expression Region:1-111 Sequence Info:fµLl length protein