ELISA Recombinant Rat Voltage-dependent calcium channel gamma-5 subunit(Cacng5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q8VHW8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTCGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQNQSTEVKMSLHSGLWR VCFLAGEERGRCFTIEYVMPMNSQMTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEmLNRTKDAETYFNYKYGWSFA FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWIRG RSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC Protein Names:Recommended name: Voltage-dependent calcium channel gamma-5 subunit Alternative name(s): Neuronal voltage-gated calcium channel gamma-5 subunit Transmembrane AMPAR regµLatory protein gamma-5 Short name= TARP gamma-5 Gene Names:Name:Cacng5 Expression Region:1-275 Sequence Info:fµLl length protein