ELISA Recombinant Rat Voltage-dependent calcium channel gamma-5 subunit(Cacng5)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:Q8VHW8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTCGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQNQSTEVKMSLHSGLWR VCFLAGEERGRCFTIEYVMPMNSQMTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEmLNRTKDAETYFNYKYGWSFA FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWIRG RSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC
Protein Names:Recommended name: Voltage-dependent calcium channel gamma-5 subunit Alternative name(s): Neuronal voltage-gated calcium channel gamma-5 subunit Transmembrane AMPAR regµLatory protein gamma-5 Short name= TARP gamma-5
Gene Names:Name:Cacng5
Expression Region:1-275
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.