ELISA Recombinant Rhizobium radiobacter Putative K(+)-stimulated pyrophosphate-energized sodium pump(hppA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) Uniprot NO.:Q8VPZ0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AGGIAEMAELGPEVRKTTDKLDSVGNTTAAIAKGFAIGSAALTALALFTAFAEEIAKNPK LTGLLVDGHLVVNLTEPGVIIGIFLGATLPFLVCAFTMEAVGKAAFEMIEEVRRQFREIP GIMEGTGRPDYAKCVDISTKAAIREMmLPGVFAVGAPLIVGFLLGAKALAGFLAGVTASG VLLAIFSPS Protein Names:Recommended name: Putative K(+)-stimµLated pyrophosphate-energized sodium pump EC= 3.6.1.1 Alternative name(s): Membrane-bound sodium-translocating pyrophosphatase Pyrophosphate-energized inorganic pyrophosphatase Short name= Na( Gene Names:Name:hppA Synonyms:vppA Expression Region:1-189 Sequence Info:fµLl length protein