Skip to Content

ELISA Recombinant Rat Trace amine-associated receptor 8b(Taar8b)

https://www.anagnostics.com/web/image/product.template/153131/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q923Y3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSNFSQATLQLCYENVNASCIKTPYSPGLRVLLYMVFGFGAVLAVCGNLLVVISVLHFK QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDTFCSLHSCCDAAFCYSSLF HLCFISVDRYIAVTEPLVYPTKFTMSVSGICISISWILPLVYSSAVFYTGISATGIENLV SALNCVGGCQVAINQDWVLISFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSISGSKGE SSLESHKARVAKRERKAAKTLGVTVMAFMVSWLPYTIDTLIDAFMGFITPAYVYEICGWI AYYNSAMNPLIYAFFYPWFRKAIKLILSGKILKGHSSTTSLFSE Protein Names:Recommended name: Trace amine-associated receptor 8b Short name= TaR-8b Short name= Trace amine receptor 8b Alternative name(s): Trace amine receptor 7 Short name= TaR-7 Gene Names:Name:Taar8b Synonyms:Ta7, Tar7, Trar7 Expression Region:1-344 Sequence Info:fµLl length protein

1,698.00 € 1698.0 EUR 1,698.00 €

1,698.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.