ELISA Recombinant Saccharomyces cerevisiae Late endosome and vacuole interface protein 10(ENV10)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q99382 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGKAGRKQASSNAKIIQGLYKQVSLFLGMAIVRLFISRKVTIGQWIKLVALNVPMFVAL YIIVLSGKPKYDGNRVVKQGIDLNDNTNLISYFFDLIYLSLFGNIGIIAFRTFKFWWCLL LCPIYAGYKLYGLKNMFMPGAQQTQADNRSKNANEGQSKSKRQMKRERRGETDSKIKYKY R Protein Names:Recommended name: Late endosome and vacuole interface protein 10 Gene Names:Name:ENV10 Ordered Locus Names:YLR065C ORF Names:L2180 Expression Region:1-181 Sequence Info:fµLl length protein