ELISA Recombinant Rat Bcl-2-like protein 10(Bcl2l10)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q99M66 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGDPLQDRTRRLLTDYILFCARAPNTPEPLPTSVEAALLRSVTSQIQQEHQDLFNSFRDY QGNRLELVTQMADELLSNDQEFNWGRLVmLLAFVGTLMNQDRTVKRRRDQRNRLLLERDC YLIVSLLYNRLTGRHRSWLEAHGGWDGFCQFFKNPLPPGFWRRLLIRAILSCFFATAIFY IWKCL Protein Names:Recommended name: Bcl-2-like protein 10 Short name= Bcl2-L-10 Gene Names:Name:Bcl2l10 Expression Region:1-185 Sequence Info:fµLl length protein