ELISA Recombinant Zea mays Aquaporin SIP2-1(SIP2-1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q9ATM1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSPAPSRPRIRPWLVVGDLALAAAWVCAGALVKLLVYGGLGLGGRPEAEAVKVSLSLVYM FLFAWLEAASGGASYNPLTVLAAALASHGGPAVYLFTAFARIPAQVIGAVLGVKLIQVTF PNVGKGARLSVGAHHGALAEGLATFMVVMVSVTLKKKEMKSFFMKTWITSIWKNTIHLLS SDITGGIMNPASAFAWAYARGDHTTFDHLLVYWLAPLQATLLGVWAVTFFTKPKKIKEQK VDENKIKKE Protein Names:Recommended name: Aquaporin SIP2-1 Alternative name(s): Small basic intrinsic protein 2-1 ZmSIP2-1 ZmSIP2;1 Gene Names:Name:SIP2-1 Synonyms:SIP2A Expression Region:1-249 Sequence Info:fµLl length protein