ELISA Recombinant Zea mays Aquaporin NIP3-1(NIP3-1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q9ATN1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEPGSTPPNGSAPATPGTPAPLFSSGGPRVDSLSYERKSMPRCKCLPLPAVEGWGVATHT CVVEIPAPDVSLTRKLGAEFVGTFILIFFATAAPIVNQKYGGAISPFGNAACAGLAVATV ILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVAVQALASVCAAFALKGVFHPFLSGG VTVPDATVSTAQAFFTEFIISFNLLFVVTAVATDTRAVGELAGIAVGAAVTLNILVAGPT TGGSMNPVRTLGPAVAAGNYRQLWIYLLAPTLGALAGASVYKAVKLRDENGETPRTQRSF RR Protein Names:Recommended name: Aquaporin NIP3-1 Alternative name(s): NOD26-like intrinsic protein 3-1 ZmNIP3-1 ZmNIP3;1 Gene Names:Name:NIP3-1 Synonyms:NIP3A Expression Region:1-302 Sequence Info:fµLl length protein