ELISA Recombinant Saccharomyces cerevisiae ADIPOR-like receptor IZH4(IZH4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q99393 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVSLTTIEQSPVKCETTTEKESNDTRGTDSNENAETKETKKGFPFHDLAKLQKQYKNKSS RNESLVALIYLLGSmLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHF IYHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGL VAYFFILTDKLISSKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITWE LVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILMHS SLNQPELINFKS Protein Names:Recommended name: ADIPOR-like receptor IZH4 Alternative name(s): Implicated in zinc homeostasis protein 4 Gene Names:Name:IZH4 Ordered Locus Names:YOL101C Expression Region:1-312 Sequence Info:fµLl length protein