ELISA Recombinant Zea mays Aquaporin NIP1-1(NIP1-1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q9ATN4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGGGDHSQTNGGHVDQRALEEGRKEEFADQGCAAMVVSVPFIQKIIAEIFGTYFLMFAG CGAVTINASKNGQITFPGVAIVWGLAVMVMVYAVGHISGAHFNPAVTLAFATSGRFPWRQ LPAYVLAQmLGATLASGTLRLMFGGRHEHFPGTLPTGSEVQSLVIEIITTFYLMFVISGV ATDNRAIGELAGLAVGATILLNVLIAGPVSGASMNPARSVGPALVSGEYTSIWVYVVGPV VGAVAGAWAYNLIRFTNKPLREITKSTSFLKSTSRMNSAASA Protein Names:Recommended name: Aquaporin NIP1-1 Alternative name(s): NOD26-like intrinsic protein 1-1 ZmNIP1-1 ZmNIP1;1 Gene Names:Name:NIP1-1 Expression Region:1-282 Sequence Info:fµLl length protein